PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID CA12g00830
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Solanoideae; Capsiceae; Capsicum
Family HD-ZIP
Protein Properties Length: 717aa    MW: 81574.4 Da    PI: 6.2453
Description HD-ZIP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
CA12g00830genomePEPView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox55.11.3e-172677556
                SS--HHHHHHHHHHHHHSSS--HHHHHHHHHHCTS-HHHHHHHHHHHHHHHH CS
    Homeobox  5 ttftkeqleeLeelFeknrypsaeereeLAkklgLterqVkvWFqNrRakek 56
                ++++ eq+++Le++F+++++p++++r +L+k+ gL+ +q+k+WFqN+R++ k
  CA12g00830 26 HRHNVEQIQQLEAFFKQCPHPDENQRNQLSKEAGLDPKQIKFWFQNKRTQTK 77
                467889*******************************************988 PP

2START102.66.7e-332384573205
                 HHHHHHHHHHHHHHC-TT-EEEE......EXCCTTEEEEEEESSS.......SCEEEEEEEECCSCHHHHHHHHHCCCGGCT-TT-S....EEEEEEEE CS
       START   3 aeeaaqelvkkalaeepgWvkss......esengdevlqkfeeskv......dsgealrasgvvdmvlallveellddkeqWdetla....kaetlevi 85 
                  + a++e +++   +ep+Wv+ s        +n++ v + +            + e +++sgvv m++ +l + ++d   +W ++++    +a   e  
  CA12g00830 238 INGAMEEMMQLLPMNEPFWVTTSdgrcllNRDNYERVFSHPYH--RpyrsstAQFESSKESGVVSMPAIELIQNFVDPV-KWMNMFPsivqQARGFELP 333
                 567999*****************99977766666666666533..1467777999************************.*******887744444444 PP

                 CTT...EEEEEEEEXXTTXX-SSX.EEEEEEEEEEE.TTS-EEEEEEEEE-TTS--.-TTSEE-EESSEEEEEEEECTCEEEEEEEE-EE--SS.XXHH CS
       START  86 ssg...galqlmvaelqalsplvp.RdfvfvRyirqlgagdwvivdvSvdseqkppesssvvRaellpSgiliepksnghskvtwvehvdlkgr.lphw 179
                 ++    g +q m+ +l  lsplv  Rdf+f+R++r+l + +w+ vdvS d  ++ + + + +   ++pSg++i++++ng s vtw+ehv  +++ ++h 
  CA12g00830 334 DTEhlgGSIQMMQEKLHILSPLVEvRDFYFIRCCRRLDQTTWIMVDVSHDILKEFQ-NGGPIYTWKYPSGCVIQDMGNGQSMVTWIEHVQIDDKnQVHR 431
                 444777******************************************99999888.67888889**************************875277** PP

                 HHHHHHHHHHHHHHHHHHHHTXXXXX CS
       START 180 llrslvksglaegaktwvatlqrqce 205
                 ++r lv  ++ +gak+w  +lqr  e
  CA12g00830 432 IFRDLVYGRQTFGAKRWIVALQRMSE 457
                 **********************9877 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.10.604.4E-18873IPR009057Homeodomain-like
SuperFamilySSF466893.68E-171179IPR009057Homeodomain-like
PROSITE profilePS5007116.4221979IPR001356Homeobox domain
SMARTSM003892.5E-161983IPR001356Homeobox domain
CDDcd000865.80E-162079No hitNo description
PfamPF000464.1E-152677IPR001356Homeobox domain
PROSITE patternPS0002705477IPR017970Homeobox, conserved site
PROSITE profilePS5084831.244227461IPR002913START domain
CDDcd088753.42E-67231457No hitNo description
SuperFamilySSF559617.0E-23235458No hitNo description
SMARTSM002342.1E-10236458IPR002913START domain
PfamPF018526.0E-26239457IPR002913START domain
Gene3DG3DSA:3.30.530.204.4E-5336424IPR023393START-like domain
SuperFamilySSF559616.18E-5481678No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0008289Molecular Functionlipid binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 717 aa     Download sequence    Send to blast
MTDSEEEHVG ESSNSQKKTR RKRQCHRHNV EQIQQLEAFF KQCPHPDENQ RNQLSKEAGL  60
DPKQIKFWFQ NKRTQTKTQT ERSDNSTLRA ENERFHCENM AMKEALKSVT CPRCDGPPIG  120
EEERTRNIEI LKMENQNLKD EHERVANLIS RVQGRSFLTN QNLALPNATL RSPSNSSDES  180
LLSQNICGSP IEFPSAQENN NNRNSINSNN IPMMSQIGQE NYQILHDIRE KAIVTEVING  240
AMEEMMQLLP MNEPFWVTTS DGRCLLNRDN YERVFSHPYH RPYRSSTAQF ESSKESGVVS  300
MPAIELIQNF VDPVKWMNMF PSIVQQARGF ELPDTEHLGG SIQMMQEKLH ILSPLVEVRD  360
FYFIRCCRRL DQTTWIMVDV SHDILKEFQN GGPIYTWKYP SGCVIQDMGN GQSMVTWIEH  420
VQIDDKNQVH RIFRDLVYGR QTFGAKRWIV ALQRMSERCN FAVAATSPTS HDLNIGVVTD  480
PEGVKNVMQT SQRMVKRFFE ILSMTDRLDF LTSSKLNSGD RVSIRTNEEI TLSPKGWIVT  540
AATSLCLPLS FQTVFDFFKD DKTRHEVCIE PLYNNVVYSD VLLVVTMKYC YREDDNLTWI  600
NMLMIQESNI DEMGAFIIYA PIDLPTVTSV INGGDATKVS ILPSGITISP DGQLASNRKN  660
TGNAQDGSIL TVAFQILISG DNYPMNQQKH MDAVASVHGL LSSKVLKVKA ALGCSD*
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_016549855.10.0PREDICTED: homeobox-leucine zipper protein ROC8-like
TrEMBLK4D5Z90.0K4D5Z9_SOLLC; Uncharacterized protein
STRINGSolyc11g011940.1.10.0(Solanum lycopersicum)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA10211732
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G03260.11e-156homeodomain GLABROUS 8